SLUG Antikörper

Produktnummer ABIN4952602

Der Kaninchen Polyklonal Anti-SLUG-Antikörper wurde für WB und IHC (p) validiert. Er ist geeignet, SLUG in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für SLUG Antikörper (ABIN4952602)

Target: SLUG (SNAI2) (Snail Family Zinc Finger 2 (SNAI2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLUG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-SLUG Antikörper

Aufreinigung: Antigen affinity

Immunogen: Amino acids KLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQ of human SLUG were used as the immunogen for the SLUG antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the SLUG antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the SLUG antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu SLUG

Target: SLUG (SNAI2) (Snail Family Zinc Finger 2 (SNAI2))

Andere Bezeichnung: SLUG / SNAI2

Hintergrund: SLUG is also known as SNAI2. This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects.

UniProt: O43623